PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000177010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 257aa    MW: 29425.7 Da    PI: 8.449
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000177010genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.89e-171057148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed +lv+ v ++G ++W+ Ia+  g++Rt+k+c++rw +yl
    MDP0000177010 10 KGPWTEQEDFQLVCFVGLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYL 57
                     79********************************************97 PP

2Myb_DNA-binding54.62.5e-1763108148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E+ l ++++ ++G++ W++Iar+++ gRt++++k++w++++
    MDP0000177010  63 RGKMTPQEERLVLELHSKWGNR-WSRIARKLP-GRTDNEIKNYWRTHM 108
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.706557IPR017930Myb domain
SuperFamilySSF466893.03E-298104IPR009057Homeodomain-like
SMARTSM007174.8E-15959IPR001005SANT/Myb domain
PfamPF002491.7E-151057IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.7E-201164IPR009057Homeodomain-like
CDDcd001673.37E-101257No hitNo description
PROSITE profilePS5129427.83558112IPR017930Myb domain
SMARTSM007177.6E-1762110IPR001005SANT/Myb domain
PfamPF002491.0E-1563107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-2465111IPR009057Homeodomain-like
CDDcd001672.07E-1165108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MVQDQEQIRK GPWTEQEDFQ LVCFVGLFGD RRWDFIAKVS GLNRTGKSCR LRWVNYLHPD  60
LKRGKMTPQE ERLVLELHSK WGNRWSRIAR KLPGRTDNEI KNYWRTHMRK KAQEKKRAMS  120
PSSSSSNCSS SSNITTTEGG ESFYDTGGKK PKASSGGKKT GGGDEVKEDE KREQREYSLD  180
DIWKDINLPE VSSIVPVYDG NLSSCPLMAS PTPWEYXSDS LWKMDLEEES KNMFLPTPSG  240
DHQFLSCYEY GKASLTG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-28101124105MYB PROTO-ONCOGENE PROTEIN
1h88_C5e-28711255159MYB PROTO-ONCOGENE PROTEIN
1h89_C5e-28711255159MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-28101124105C-Myb DNA-Binding Domain
1msf_C1e-28101124105C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1155162GGKKTGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008385168.10.0PREDICTED: transcription factor MYB59-like isoform X1
SwissprotQ9LX824e-88MYB48_ARATH; Transcription factor MYB48
TrEMBLM5W1561e-129M5W156_PRUPE; Uncharacterized protein (Fragment)
STRINGVIT_06s0004g04140.t011e-105(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43783359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.14e-81myb domain protein 48